FMO3 antibody (N-Term)
-
- Target See all FMO3 Antibodies
- FMO3 (Flavin Containing Monooxygenase 3 (FMO3))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FMO3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FMO3 antibody was raised against the N terminal of FMO3
- Purification
- Affinity purified
- Immunogen
- FMO3 antibody was raised using the N terminal of FMO3 corresponding to a region with amino acids FMHNSKIQEYIIAFAKEKNLLKYIQFKTFVSSVNKHPDFATTGQWDVTTE
- Top Product
- Discover our top product FMO3 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FMO3 Blocking Peptide, catalog no. 33R-2997, is also available for use as a blocking control in assays to test for specificity of this FMO3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FMO3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FMO3 (Flavin Containing Monooxygenase 3 (FMO3))
- Alternative Name
- FMO3 (FMO3 Products)
- Synonyms
- MGC107820 antibody, FMOII antibody, TMAU antibody, dJ127D3.1 antibody, FM03 antibody, AW111792 antibody, flavin containing monooxygenase 3 antibody, flavin containing monooxygenase 3 L homeolog antibody, FMO3 antibody, fmo3 antibody, fmo3.L antibody, Fmo3 antibody
- Background
- FMO3 is involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides. It N-oxygenates primary aliphatic alkylamines as well as secondary and tertiary amines. It acts on TMA to produce TMA-N-oxide.
- Molecular Weight
- 59 kDa (MW of target protein)
-