FNDC4 antibody (Middle Region)

Catalog No. ABIN635170

Product Details anti-FNDC4 Antibody

Target: FNDC4 (Fibronectin Type III Domain Containing 4 (FNDC4))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FNDC4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FNDC4 antibody was raised against the middle region of FNDC4

Purification: Affinity purified

Immunogen: FNDC4 antibody was raised using the middle region of FNDC4 corresponding to a region with amino acids EGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FNDC4 Blocking Peptide, catalog no. 33R-2440, is also available for use as a blocking control in assays to test for specificity of this FNDC4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FNDC4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FNDC4

Target: FNDC4 (Fibronectin Type III Domain Containing 4 (FNDC4))

Alternative Name: FNDC4 (FNDC4 Products)

Synonyms: 2810430J06Rik antibody, 6330410H20Rik antibody, AB030187 antibody, AI838506 antibody, AW487863 antibody, FRCP1 antibody, Fnmp1 antibody, FNDC4 antibody, fibronectin type III domain containing 4 antibody, Fndc4 antibody, FNDC4 antibody, fndc4 antibody

Background: The function of Fibronectin protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 25 kDa (MW of target protein)