DLG3 antibody
-
- Target See all DLG3 Antibodies
- DLG3 (Discs, Large Homolog 3 (DLG3))
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DLG3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- DLG3 antibody was raised using a synthetic peptide corresponding to a region with amino acids HEQAAAALKRAGQSVTIVAQYRPEEYSRFESKIHDLREQMMNSSMSSGSG
- Top Product
- Discover our top product DLG3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DLG3 Blocking Peptide, catalog no. 33R-3722, is also available for use as a blocking control in assays to test for specificity of this DLG3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLG3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DLG3 (Discs, Large Homolog 3 (DLG3))
- Alternative Name
- DLG3 (DLG3 Products)
- Synonyms
- MRX antibody, MRX90 antibody, NEDLG antibody, SAP102 antibody, XLMR antibody, DLG3 antibody, fa66c08 antibody, fa66e02 antibody, fd02c12 antibody, fu95c12 antibody, im:7138640 antibody, si:ch211-276g21.1 antibody, wu:fa66c08 antibody, wu:fa66e02 antibody, wu:fd02c12 antibody, wu:fu95c12 antibody, Dlgh3 antibody, mKIAA1232 antibody, MPP3 antibody, 6430514B01 antibody, CSG18 antibody, Dlg3 antibody, Dusp3 antibody, discs large MAGUK scaffold protein 3 antibody, membrane palmitoylated protein 3 antibody, discs, large homolog 3 (Drosophila) antibody, membrane protein, palmitoylated 3 (MAGUK p55 subfamily member 3) antibody, DLG3 antibody, MPP3 antibody, dlg3 antibody, Dlg3 antibody, Mpp3 antibody
- Background
- DLG3 is required for learning most likely through its role in synaptic plasticity following NMDA receptor signaling. Defects in DLG3 are the cause of mental retardation X-linked type 90 (MRX90).
- Molecular Weight
- 58 kDa (MW of target protein)
-