SSR1 antibody (Middle Region)
-
- Target See all SSR1 Antibodies
- SSR1 (Signal Sequence Receptor, alpha (SSR1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SSR1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SSR1 antibody was raised against the middle region of SSR1
- Purification
- Affinity purified
- Immunogen
- SSR1 antibody was raised using the middle region of SSR1 corresponding to a region with amino acids FTNKGTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQRQATFEY
- Top Product
- Discover our top product SSR1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SSR1 Blocking Peptide, catalog no. 33R-3096, is also available for use as a blocking control in assays to test for specificity of this SSR1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SSR1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SSR1 (Signal Sequence Receptor, alpha (SSR1))
- Alternative Name
- SSR1 (SSR1 Products)
- Synonyms
- cb758 antibody, trapa antibody, Ssr1 antibody, TRAPA antibody, 2510001K09Rik antibody, 6330400D04 antibody, AI159733 antibody, AI452176 antibody, SSR antibody, signal sequence receptor, alpha antibody, signal sequence receptor, alpha (translocon-associated protein alpha) antibody, signal sequence receptor subunit 1 antibody, signal sequence receptor, alpha (translocon-associated protein alpha) S homeolog antibody, ssr1 antibody, SSR1 antibody, Ssr1 antibody, ssr1.S antibody
- Background
- The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR consists of 2 subunits, a 34 kDa glycoprotein encoded by this gene and a 22 kDa glycoprotein.
- Molecular Weight
- 32 kDa (MW of target protein)
- Pathways
- ER-Nucleus Signaling
-