DLG2 antibody
-
- Target See all DLG2 Antibodies
- DLG2 (Discs, Large Homolog 2 (DLG2))
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DLG2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- DLG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFFACYCALRTNVKKYRYQDEDAPHDHSLPRLTHEVRGPELVHVSEKNLS
- Top Product
- Discover our top product DLG2 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DLG2 Blocking Peptide, catalog no. 33R-5991, is also available for use as a blocking control in assays to test for specificity of this DLG2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLG2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DLG2 (Discs, Large Homolog 2 (DLG2))
- Alternative Name
- DLG2 (DLG2 Products)
- Synonyms
- PPP1R58 antibody, PSD-93 antibody, PSD93 antibody, chapsyn-110 antibody, A330103J02Rik antibody, B230218P12Rik antibody, B330007M19Rik antibody, Dlgh2 antibody, Gm1197 antibody, discs, large homolog 2 (Drosophila) antibody, discs large MAGUK scaffold protein 2 antibody, dlg2 antibody, DLG2 antibody, Dlg2 antibody
- Background
- DLG2 is a member of the membrane-associated guanylate kinase (MAGUK) family. The protein forms a heterodimer with a related family member that may interact at postsynaptic sites to form a multimeric scaffold for the clustering of receptors, ion channels, and associated signaling proteins.
- Molecular Weight
- 97 kDa (MW of target protein)
-