PEX10 antibody (Middle Region)
-
- Target See all PEX10 Antibodies
- PEX10 (Peroxisomal Biogenesis Factor 10 (PEX10))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PEX10 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- PEX10 antibody was raised against the middle region of PEX10
- Purification
- Affinity purified
- Immunogen
- PEX10 antibody was raised using the middle region of PEX10 corresponding to a region with amino acids QALRPDPLRVLMSVAPSALQLRVRSLPGEDLRARVSYRLLGVISLLHLVL
- Top Product
- Discover our top product PEX10 Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PEX10 Blocking Peptide, catalog no. 33R-7469, is also available for use as a blocking control in assays to test for specificity of this PEX10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEX10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PEX10 (Peroxisomal Biogenesis Factor 10 (PEX10))
- Alternative Name
- PEX10 (PEX10 Products)
- Synonyms
- ATPEX10 antibody, T9J22.2 antibody, peroxin 10 antibody, NALD antibody, PBD6A antibody, PBD6B antibody, RNF69 antibody, AV128229 antibody, Gm142 antibody, peroxin 10 antibody, peroxisomal biogenesis factor 10 antibody, PEX10 antibody, Pex10 antibody
- Background
- PEX10 is a protein involved in import of peroxisomal matrix proteins. This protein localizes to the peroxisomal membrane. Mutations in PEX10 gene result in phenotypes within the Zellweger spectrum of peroxisomal biogenesis disorders, ranging from neonatal adrenoleukodystrophy to Zellweger syndrome.
- Molecular Weight
- 39 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-