ORCTL-2/SLC22A18 antibody (N-Term)

Catalog No. ABIN635226

Product Details anti-ORCTL-2/SLC22A18 Antibody

Target: ORCTL-2/SLC22A18 (SLC22A18) (Solute Carrier Family 22 Member 18 (SLC22A18))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ORCTL-2/SLC22A18 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SLC22 A18 antibody was raised against the N terminal of SLC22 18

Purification: Affinity purified

Immunogen: SLC22 A18 antibody was raised using the N terminal of SLC22 18 corresponding to a region with amino acids AASSPALPGVYLLFASRLPGALMHTLPAAQMVITDLSAPEERPAALGRLG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC22A18 Blocking Peptide, catalog no. 33R-1050, is also available for use as a blocking control in assays to test for specificity of this SLC22A18 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 18 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ORCTL-2/SLC22A18

Target: ORCTL-2/SLC22A18 (SLC22A18) (Solute Carrier Family 22 Member 18 (SLC22A18))

Alternative Name: SLC22A18 (SLC22A18 Products)

Synonyms: MGC123168 antibody, zgc:123168 antibody, BWR1A antibody, BWSCR1A antibody, HET antibody, IMPT1 antibody, ITM antibody, ORCTL2 antibody, SLC22A1L antibody, TSSC5 antibody, p45-BWR1A antibody, AW260131 antibody, Impt1 antibody, Orctl2 antibody, Slc22a1l antibody, solute carrier family 22, member 18 antibody, solute carrier family 22 member 18 antibody, solute carrier family 22 (organic cation transporter), member 18 antibody, slc22a18 antibody, SLC22A18 antibody, Slc22a18 antibody

Background: This gene is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. This gene may play a role in malignancies and disease that involve this region as well as the transport of chloroquine- and quinidine-related compounds in the kidney.

Molecular Weight: 45 kDa (MW of target protein)