SLC41A3 antibody (C-Term)

Catalog No. ABIN635242

Product Details anti-SLC41A3 Antibody

Target: SLC41A3 (Solute Carrier Family 41, Member 3 (SLC41A3))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC41A3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SLC41 A3 antibody was raised against the C terminal of SLC41 3

Purification: Affinity purified

Immunogen: SLC41 A3 antibody was raised using the C terminal of SLC41 3 corresponding to a region with amino acids WHQALDPDNHCIPYLTGLGDLLGSSSVGHTAAVPRRCTASPGWGLIQPFI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC41A3 Blocking Peptide, catalog no. 33R-9954, is also available for use as a blocking control in assays to test for specificity of this SLC41A3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC41A3

Target: SLC41A3 (Solute Carrier Family 41, Member 3 (SLC41A3))

Alternative Name: SLC41A3 (SLC41A3 Products)

Synonyms: slc41a1-l2 antibody, slc41a3.2 antibody, SLC41A1-L2 antibody, 1010001P06Rik antibody, AI480742 antibody, solute carrier family 41 member 3 antibody, solute carrier family 41 member 3 L homeolog antibody, solute carrier family 41, member 3 antibody, SLC41A3 antibody, slc41a3.L antibody, Slc41a3 antibody

Background: SLC41A3 is a multi-pass membrane protein. It belongs to the SLC41A transporter family. The exact function of SLC41A3 remains unknown.

Molecular Weight: 55 kDa (MW of target protein)