Dystroglycan antibody
-
- Target See all Dystroglycan (DAG1) Antibodies
- Dystroglycan (DAG1) (Dystroglycan 1 (DAG1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Dystroglycan antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- DAG1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRDPVPGKPTVTIRT
- Top Product
- Discover our top product DAG1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DAG1 Blocking Peptide, catalog no. 33R-1265, is also available for use as a blocking control in assays to test for specificity of this DAG1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAG1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Dystroglycan (DAG1) (Dystroglycan 1 (DAG1))
- Alternative Name
- DAG1 (DAG1 Products)
- Synonyms
- LOC398500 antibody, dag1 antibody, MGC53537 antibody, 156DAG antibody, A3a antibody, AGRNR antibody, DAG antibody, MDDGC7 antibody, MDDGC9 antibody, DAG1 antibody, RAB7 antibody, dg antibody, a3a antibody, dag antibody, agrnr antibody, 156dag antibody, D9Wsu13e antibody, DG antibody, Dp427 antibody, Dp71 antibody, CG18250 antibody, CT41273 antibody, DmDG antibody, Dmel\\CG18250 antibody, atu antibody, dgn antibody, dys antibody, GB14967 antibody, APOJ antibody, CLI antibody, RATTRPM2B antibody, SGP-2 antibody, SGP2 antibody, SP-40 antibody, SP40 antibody, TRPM-2 antibody, TRPM2B antibody, Trpm2 antibody, Trpmb antibody, Ala-1 antibody, H9/25 antibody, Ly-27 antibody, Ly-6 antibody, Ly27 antibody, wu:fb83d06 antibody, wu:fi25f06 antibody, wu:fi37b08 antibody, zgc:109786 antibody, DystroGlycaN antibody, dystroglycan 1 L homeolog antibody, dystroglycan 1 antibody, dystroglycan 1 S homeolog antibody, Dystroglycan antibody, dystroglycan antibody, clusterin antibody, lymphocyte antigen 6 complex antibody, dgn-1 antibody, dag1.L antibody, dgn-2 antibody, dgn-3 antibody, DAG1 antibody, dag1.S antibody, Dag1 antibody, dag1 antibody, Dg antibody, LOC408826 antibody, Clu antibody, Ly6 antibody
- Background
- Dystroglycan is a laminin binding component of the dystrophin-glycoprotein complex which provides a linkage between the subsarcolemmal cytoskeleton and the extracellular matrix.
- Molecular Weight
- 27 kDa (MW of target protein)
- Pathways
- Maintenance of Protein Location, Regulation of Carbohydrate Metabolic Process, Protein targeting to Nucleus
-