LTB antibody

Catalog No. ABIN635263

Product Details anti-LTB Antibody

Target: LTB (Lymphotoxin beta (TNF Superfamily, Member 3) (LTB))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LTB antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: LTB antibody was raised using a synthetic peptide corresponding to a region with amino acids AVPITVLAVLALVPQDQGGLVTETADPGAQAQQGLGFQKLPEEEPETDLS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LTB Blocking Peptide, catalog no. 33R-1610, is also available for use as a blocking control in assays to test for specificity of this LTB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LTB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LTB

Target: LTB (Lymphotoxin beta (TNF Superfamily, Member 3) (LTB))

Alternative Name: LTB (LTB Products)

Synonyms: AI662801 antibody, LTbeta antibody, Tnfc antibody, Tnfsf3 antibody, p33 antibody, TNFC antibody, TNFSF3 antibody, LT-b antibody, LT-beta antibody, TNF-C antibody, lymphotoxin B antibody, lymphotoxin beta antibody, Ltb antibody, LTB antibody

Background: Lymphotoxin beta is a type II membrane protein of the TNF family. It anchors lymphotoxin-alpha to the cell surface through heterotrimer formation. The predominant form on the lymphocyte surface is the lymphotoxin-alpha 1/beta 2 complex (e.g. 1 molecule alpha/2 molecules beta) and this complex is the primary ligand for the lymphotoxin-beta receptor.

Molecular Weight: 25 kDa (MW of target protein)

Pathways: NF-kappaB Signaling