LTB antibody
-
- Target See all LTB Antibodies
- LTB (Lymphotoxin beta (TNF Superfamily, Member 3) (LTB))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LTB antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- LTB antibody was raised using a synthetic peptide corresponding to a region with amino acids AVPITVLAVLALVPQDQGGLVTETADPGAQAQQGLGFQKLPEEEPETDLS
- Top Product
- Discover our top product LTB Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LTB Blocking Peptide, catalog no. 33R-1610, is also available for use as a blocking control in assays to test for specificity of this LTB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LTB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LTB (Lymphotoxin beta (TNF Superfamily, Member 3) (LTB))
- Alternative Name
- LTB (LTB Products)
- Synonyms
- AI662801 antibody, LTbeta antibody, Tnfc antibody, Tnfsf3 antibody, p33 antibody, TNFC antibody, TNFSF3 antibody, LT-b antibody, LT-beta antibody, TNF-C antibody, lymphotoxin B antibody, lymphotoxin beta antibody, Ltb antibody, LTB antibody
- Background
- Lymphotoxin beta is a type II membrane protein of the TNF family. It anchors lymphotoxin-alpha to the cell surface through heterotrimer formation. The predominant form on the lymphocyte surface is the lymphotoxin-alpha 1/beta 2 complex (e.g. 1 molecule alpha/2 molecules beta) and this complex is the primary ligand for the lymphotoxin-beta receptor.
- Molecular Weight
- 25 kDa (MW of target protein)
- Pathways
- NF-kappaB Signaling
-