SLC39A4 antibody
-
- Target See all SLC39A4 Antibodies
- SLC39A4 (Solute Carrier Family 39 (Zinc Transporter), Member 4 (SLC39A4))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC39A4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC39 A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLGLHTHSEEGLSPQPTWRLLAMLAGLYAFFLFENLFNLLLPRDPEDLED
- Top Product
- Discover our top product SLC39A4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC39A4 Blocking Peptide, catalog no. 33R-9661, is also available for use as a blocking control in assays to test for specificity of this SLC39A4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC39A4 (Solute Carrier Family 39 (Zinc Transporter), Member 4 (SLC39A4))
- Alternative Name
- SLC39A4 (SLC39A4 Products)
- Synonyms
- AEZ antibody, AWMS2 antibody, ZIP4 antibody, 1600025H15Rik antibody, AU041686 antibody, solute carrier family 39 member 4 antibody, solute carrier family 39 (zinc transporter), member 4 antibody, SLC39A4 antibody, slc39a4 antibody, Slc39a4 antibody
- Background
- SLC39A4 is a member of the zinc/iron-regulated transporter-like protein (ZIP) family. The transmembrane protein is required for zinc uptake in the intestine. Mutations in the gene encoding SLC39A4 result in acrodermatitis enteropathica, a rare inherited defect in the absorption of dietary zinc.
- Molecular Weight
- 66 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis, Autophagy
-