Transferrin Receptor 2 antibody (Middle Region)
-
- Target See all Transferrin Receptor 2 (TFR2) Antibodies
- Transferrin Receptor 2 (TFR2)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Transferrin Receptor 2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TFR2 antibody was raised against the middle region of TFR2
- Purification
- Affinity purified
- Immunogen
- TFR2 antibody was raised using the middle region of TFR2 corresponding to a region with amino acids YVSLDNAVLGDDKFHAKTSPLLTSLIESVLKQVDSPNHSGQTLYEQVVFT
- Top Product
- Discover our top product TFR2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TFR2 Blocking Peptide, catalog no. 33R-10285, is also available for use as a blocking control in assays to test for specificity of this TFR2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TFR2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Transferrin Receptor 2 (TFR2)
- Alternative Name
- TFR2 (TFR2 Products)
- Synonyms
- TFR2 antibody, Trfr2 antibody, HFE3 antibody, TFRC2 antibody, zgc:123043 antibody, transferrin receptor 2 antibody, TFR2 antibody, Tfr2 antibody, tfr2 antibody
- Background
- TFR2,a member of the transferrin receptor-like family,is a single-pass type II membrane protein with a protease associated (PA) domain, an M28 peptidase domain and a transferrin receptor-like dimerization domain. This protein mediates cellular uptake of transferrin-bound iron and mutations in this gene have been associated with hereditary hemochromatosis type III.
- Molecular Weight
- 89 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis
-