CCDC90A antibody (Middle Region)

Catalog No. ABIN635301

Product Details anti-CCDC90A Antibody

Target: CCDC90A (MCUR1) (Mitochondrial Calcium Uniporter Regulator 1 (MCUR1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CCDC90A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CCDC90 A antibody was raised against the middle region of CCDC90

Purification: Affinity purified

Immunogen: CCDC90 A antibody was raised using the middle region of CCDC90 corresponding to a region with amino acids ELHQLKQQVMDEVIKVRTDTKLDFNLEKSRVKELYSLNEKKLLELRTEIV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CCDC90A Blocking Peptide, catalog no. 33R-2548, is also available for use as a blocking control in assays to test for specificity of this CCDC90A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC90 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CCDC90A

Target: CCDC90A (MCUR1) (Mitochondrial Calcium Uniporter Regulator 1 (MCUR1))

Alternative Name: CCDC90A (MCUR1 Products)

Synonyms: C6orf79 antibody, CCDC90A antibody, 6230416A05Rik antibody, AU015498 antibody, AV136929 antibody, AW554392 antibody, C88263 antibody, Ccdc90a antibody, RGD1307673 antibody, mitochondrial calcium uniporter regulator 1 antibody, mitochondrial calcium uniporter regulator 1 L homeolog antibody, MCUR1 antibody, Mcur1 antibody, mcur1.L antibody

Background: The function of CCDC90A protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 40 kDa (MW of target protein)