PTPN5 antibody
-
- Target See all PTPN5 Antibodies
- PTPN5 (Protein tyrosine Phosphatase, Non-Receptor Type 5 (Striatum-Enriched) (PTPN5))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PTPN5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PTPN5 antibody was raised using a synthetic peptide corresponding to a region with amino acids VPETPVFDCVMDIKPEADPTSLTVKSMGLQERRGSNVSLTLDMCTPGCNE
- Top Product
- Discover our top product PTPN5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PTPN5 Blocking Peptide, catalog no. 33R-9722, is also available for use as a blocking control in assays to test for specificity of this PTPN5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTPN5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PTPN5 (Protein tyrosine Phosphatase, Non-Receptor Type 5 (Striatum-Enriched) (PTPN5))
- Alternative Name
- PTPN5 (PTPN5 Products)
- Synonyms
- STEP antibody, Step antibody, PTPSTEP antibody, protein tyrosine phosphatase, non-receptor type 5 antibody, ptpn5 antibody, PTPN5 antibody, Ptpn5 antibody
- Background
- The function of PTPN5 protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 60 kDa (MW of target protein)
-