RRBP1 antibody

Catalog No. ABIN635306

Product Details anti-RRBP1 Antibody

Target: RRBP1 (Ribosome Binding Protein 1 (RRBP1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RRBP1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: RRBP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TDVAQSPEAPKQEAPAKKKSGSKKKGPPDADGPLYLPYKTLVSTVGSMVF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RRBP1 Blocking Peptide, catalog no. 33R-9024, is also available for use as a blocking control in assays to test for specificity of this RRBP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RRBP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RRBP1

Target: RRBP1 (Ribosome Binding Protein 1 (RRBP1))

Alternative Name: RRBP1 (RRBP1 Products)

Synonyms: 1700087N07Rik antibody, 5730465C04Rik antibody, ES/130 antibody, mKIAA1398 antibody, mRRp0 antibody, mRRp1.8 antibody, mRRp10 antibody, mRRp15a antibody, mRRp15b antibody, mRRp16.8 antibody, mRRp2 antibody, mRRp41 antibody, mRRp47 antibody, mRRp5.4 antibody, p180 antibody, ES130 antibody, RRp antibody, hES antibody, P180 antibody, rrbp1 antibody, sb:cb489 antibody, wu:fc47a01 antibody, ribosome binding protein 1 antibody, ribosome binding protein 1 homolog 180kDa (dog) antibody, ribosome binding protein 1b antibody, Rrbp1 antibody, RRBP1 antibody, rrbp1b antibody

Background: Analysis of cDNA clones indicates that ribosome binding protein 1 may exist in different forms due to removal of tandem repeats, or partial intraexonic splicing of RRBP1. The form presented here is lacking the canine p180 ribosome-binding domain, NQGKKAEGAQ, which is tandemly repeated close to the N-terminus in other forms that haven't been fully characterized.

Molecular Weight: 109 kDa (MW of target protein)