FURIN antibody

Catalog No. ABIN635308

Product Details anti-FURIN Antibody

Target: FURIN (Furin (Paired Basic Amino Acid Cleaving Enzyme) (FURIN))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FURIN antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: FURIN antibody was raised using a synthetic peptide corresponding to a region with amino acids RDVYQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FURIN Blocking Peptide, catalog no. 33R-7864, is also available for use as a blocking control in assays to test for specificity of this FURIN antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FURIN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FURIN

Target: FURIN (Furin (Paired Basic Amino Acid Cleaving Enzyme) (FURIN))

Alternative Name: FURIN (FURIN Products)

Synonyms: FURIN antibody, furin antibody, si:dkey-281a24.5 antibody, FUR antibody, LOC100220259 antibody, PACE antibody, spc1 antibody, xfurin antibody, MGC82710 antibody, PCSK3 antibody, SPC1 antibody, 9130404I01Rik antibody, Fur antibody, Pcsk3 antibody, Pace antibody, furin, paired basic amino acid cleaving enzyme antibody, furin (paired basic amino acid cleaving enzyme) a antibody, furin (paired basic amino acid cleaving enzyme) b antibody, furin, paired basic amino acid cleaving enzyme L homeolog antibody, furin (paired basic amino acid cleaving enzyme) antibody, FURIN antibody, furina antibody, furinb antibody, furin antibody, furin.L antibody, Furin antibody

Background: The protein encoded by this gene belongs to the subtilisin-like proprotein convertase family. The members of this family are proprotein convertases that process latent precursor proteins into their biologically active products.

Molecular Weight: 74 kDa (MW of target protein)

Pathways: Notch Signaling, Neurotrophin Signaling Pathway