AADACL4 antibody (Middle Region)
-
- Target See all AADACL4 products
- AADACL4 (Arylacetamide Deacetylase-Like 4 (AADACL4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This AADACL4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- AADACL4 antibody was raised against the middle region of AADACL4
- Purification
- Affinity purified
- Immunogen
- AADACL4 antibody was raised using the middle region of AADACL4 corresponding to a region with amino acids IRAQVLIYPVVQAFCLQLPSFQQNQNVPLLSRKFMVTSLCNYLAIDLSWR
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
AADACL4 Blocking Peptide, catalog no. 33R-4128, is also available for use as a blocking control in assays to test for specificity of this AADACL4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AADACL4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- AADACL4 (Arylacetamide Deacetylase-Like 4 (AADACL4))
- Alternative Name
- AADACL4 (AADACL4 Products)
- Synonyms
- RGD1565761 antibody, OTTMUSG00000010747 antibody, Aadacl4 antibody, arylacetamide deacetylase like 4 antibody, arylacetamide deacetylase-like 4 S homeolog antibody, arylacetamide deacetylase-like 4 antibody, arylacetamide deacetylase-like 4-like 3 antibody, AADACL4 antibody, aadacl4.S antibody, aadacl4 antibody, Aadacl4 antibody, AADACL4L3 antibody, LOC100218769 antibody, LOC100713568 antibody
- Background
- The function of AADAC protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 46 kDa (MW of target protein)
-