ENPP2 antibody (N-Term)
-
- Target See all ENPP2 Antibodies
- ENPP2 (Ectonucleotide Pyrophosphatase/phosphodiesterase 2 (ENPP2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ENPP2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ENPP2 antibody was raised against the N terminal of ENPP2
- Purification
- Affinity purified
- Immunogen
- ENPP2 antibody was raised using the N terminal of ENPP2 corresponding to a region with amino acids YTLATGLYPESHGIVGNSMYDPVFDATFHLRGREKFNHRWWGGQPLWITA
- Top Product
- Discover our top product ENPP2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ENPP2 Blocking Peptide, catalog no. 33R-10264, is also available for use as a blocking control in assays to test for specificity of this ENPP2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ENPP2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ENPP2 (Ectonucleotide Pyrophosphatase/phosphodiesterase 2 (ENPP2))
- Alternative Name
- ENPP2 (ENPP2 Products)
- Synonyms
- ATX antibody, ATX-X antibody, AUTOTAXIN antibody, LysoPLD antibody, NPP2 antibody, PD-IALPHA antibody, PDNP2 antibody, Npps2 antibody, PD-Ialpha antibody, Pdnp2 antibody, MGC132047 antibody, atx antibody, zgc:63550 antibody, autotaxin antibody, enpp2 antibody, enpp2a antibody, enpp2b antibody, ectonucleotide pyrophosphatase/phosphodiesterase 2 antibody, ectonucleotide pyrophosphatase/phosphodiesterase 2 L homeolog antibody, ectonucleotide pyrophosphatase/phosphodiesterase 2 S homeolog antibody, ENPP2 antibody, Enpp2 antibody, enpp2 antibody, enpp2.L antibody, enpp2.S antibody
- Background
- The protein encoded by this gene functions as both a phosphodiesterase, which cleaves phosphodiester bonds at the 5' end of oligonucleotides, and a phospholipase, which catalyzes production of lysophosphatidic acid (LPA) in extracellular fluids. LPA evokes growth factor-like responses including stimulation of cell proliferation and chemotaxis. This gene product stimulates the motility of tumor cells and has angiogenic properties, and its expression is upregulated in several kinds of carcinomas.
- Molecular Weight
- 95 kDa (MW of target protein)
-