SLC33A1 antibody
-
- Target See all SLC33A1 Antibodies
- SLC33A1 (Solute Carrier Family 33 Member 1 (SLC33A1))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC33A1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC33 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CNSVGQTAGYFLGNVLFLALESADFCNKYLRFQPQPRGIVTLSDFLFFWG
- Top Product
- Discover our top product SLC33A1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC33A1 Blocking Peptide, catalog no. 33R-1757, is also available for use as a blocking control in assays to test for specificity of this SLC33A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC33A1 (Solute Carrier Family 33 Member 1 (SLC33A1))
- Alternative Name
- SLC33A1 (SLC33A1 Products)
- Synonyms
- zgc:63693 antibody, ACATN antibody, AT-1 antibody, AT1 antibody, CCHLND antibody, SPG42 antibody, AI315656 antibody, AI788741 antibody, Acatn antibody, D630022N01Rik antibody, solute carrier family 33 (acetyl-CoA transporter), member 1 antibody, solute carrier family 33 member 1 antibody, slc33a1 antibody, SLC33A1 antibody, Slc33a1 antibody
- Background
- SLC33A1 is required for the formation of O-acetylated (Ac) gangliosides. It is predicted to contain 6 to 10 transmembrane domains, and a leucine zipper motif in transmembrane domain III. Studies indicate that the protein is localized to the cytoplasm.
- Molecular Weight
- 61 kDa (MW of target protein)
-