SLC33A1 antibody

Catalog No. ABIN635371

Product Details anti-SLC33A1 Antibody

Target: SLC33A1 (Solute Carrier Family 33 Member 1 (SLC33A1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC33A1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SLC33 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CNSVGQTAGYFLGNVLFLALESADFCNKYLRFQPQPRGIVTLSDFLFFWG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC33A1 Blocking Peptide, catalog no. 33R-1757, is also available for use as a blocking control in assays to test for specificity of this SLC33A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC33A1

Target: SLC33A1 (Solute Carrier Family 33 Member 1 (SLC33A1))

Alternative Name: SLC33A1 (SLC33A1 Products)

Synonyms: zgc:63693 antibody, ACATN antibody, AT-1 antibody, AT1 antibody, CCHLND antibody, SPG42 antibody, AI315656 antibody, AI788741 antibody, Acatn antibody, D630022N01Rik antibody, solute carrier family 33 (acetyl-CoA transporter), member 1 antibody, solute carrier family 33 member 1 antibody, slc33a1 antibody, SLC33A1 antibody, Slc33a1 antibody

Background: SLC33A1 is required for the formation of O-acetylated (Ac) gangliosides. It is predicted to contain 6 to 10 transmembrane domains, and a leucine zipper motif in transmembrane domain III. Studies indicate that the protein is localized to the cytoplasm.

Molecular Weight: 61 kDa (MW of target protein)