SLC17A4 antibody
-
- Target See all SLC17A4 Antibodies
- SLC17A4 (Solute Carrier Family 17 (Anion/Sugar Transporter), Member 4 (SLC17A4))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC17A4 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Affinity purified
- Immunogen
- SLC17 A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YFCEYWLFYTIMAYTPTYISSVLQANLRDSGILSALPFVVGCICIILGGL
- Top Product
- Discover our top product SLC17A4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC17A4 Blocking Peptide, catalog no. 33R-10092, is also available for use as a blocking control in assays to test for specificity of this SLC17A4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC17A4 (Solute Carrier Family 17 (Anion/Sugar Transporter), Member 4 (SLC17A4))
- Alternative Name
- SLC17A4 (SLC17A4 Products)
- Synonyms
- SLC17A4 antibody, 9130214H05Rik antibody, KAIA2138 antibody, solute carrier family 17 member 4 antibody, solute carrier family 17 member 3 antibody, solute carrier family 17 (sodium phosphate), member 4 antibody, solute carrier family 17, member 4 antibody, SLC17A4 antibody, SLC17A3 antibody, Slc17a4 antibody
- Background
- As a Na/PO4 cotransporter, SLC17A4 may be important to the regulation of Li transport and its therapeutic effects.
- Molecular Weight
- 55 kDa (MW of target protein)
-