NHE8 antibody
-
- Target See all NHE8 (SLC9A8) Antibodies
- NHE8 (SLC9A8) (Solute Carrier Family 9 (Sodium/hydrogen Exchanger), Member 8 (SLC9A8))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NHE8 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC9 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids AKYLNPFFTRRLTQEDLHHGRIQMKTLTNKWYEEVRQGPSGSEDDEQELL
- Top Product
- Discover our top product SLC9A8 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC9A8 Blocking Peptide, catalog no. 33R-1315, is also available for use as a blocking control in assays to test for specificity of this SLC9A8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NHE8 (SLC9A8) (Solute Carrier Family 9 (Sodium/hydrogen Exchanger), Member 8 (SLC9A8))
- Alternative Name
- SLC9A8 (SLC9A8 Products)
- Synonyms
- 1200006P13Rik antibody, 6430709P13Rik antibody, AI182282 antibody, NHE8 antibody, nhe8 antibody, wu:fj61b02 antibody, zgc:103660 antibody, NHE-8 antibody, solute carrier family 9 member A8 antibody, solute carrier family 9 member 8 antibody, solute carrier family 9 (sodium/hydrogen exchanger), member 8 antibody, solute carrier family 9, subfamily A (NHE8, cation proton antiporter 8), member 8 antibody, SLC9A8 antibody, slc9a8 antibody, Slc9a8 antibody
- Background
- Sodium-hydrogen exchangers (NHEs), such as SLC9A8, are integral transmembrane proteins that exchange extracellular Na+ for intracellular H+. NHEs have multiple functions, including intracellular pH homeostasis, cell volume regulation, and electroneutral NaCl absorption in epithelia.
- Molecular Weight
- 65 kDa (MW of target protein)
- Pathways
- Proton Transport
-