SLC22A17 antibody (Middle Region)
-
- Target See all SLC22A17 Antibodies
- SLC22A17 (Solute Carrier Family 22 (Organic Cation Transporter), Member 17 (SLC22A17))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC22A17 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SLC22 A17 antibody was raised against the middle region of SLC22 17
- Purification
- Affinity purified
- Immunogen
- SLC22 A17 antibody was raised using the middle region of SLC22 17 corresponding to a region with amino acids HCYQPVGGGGSPSDFYLCSLLASGTAALACVFLGVTVDRFGRRGILLLSM
- Top Product
- Discover our top product SLC22A17 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC22A17 Blocking Peptide, catalog no. 33R-3704, is also available for use as a blocking control in assays to test for specificity of this SLC22A17 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 17 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC22A17 (Solute Carrier Family 22 (Organic Cation Transporter), Member 17 (SLC22A17))
- Alternative Name
- SLC22A17 (SLC22A17 Products)
- Synonyms
- 1700094C23Rik antibody, 24p3R antibody, AU041908 antibody, AW555662 antibody, BOIT antibody, Boct antibody, mBOCT antibody, BOCT antibody, NGALR antibody, NGALR2 antibody, NGALR3 antibody, hBOIT antibody, rBOCT antibody, solute carrier family 22 member 17 antibody, solute carrier family 22 (organic cation transporter), member 17 antibody, solute carrier family 22, member 17 antibody, SLC22A17 antibody, Slc22a17 antibody
- Background
- The function of SLC22A17 protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 58 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis
-