Slc38a5 antibody (N-Term)
-
- Target See all Slc38a5 Antibodies
- Slc38a5 (Solute Carrier Family 38, Member 5 (Slc38a5))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Slc38a5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SLC38 A5 antibody was raised against the N terminal of SLC38 5
- Purification
- Affinity purified
- Immunogen
- SLC38 A5 antibody was raised using the N terminal of SLC38 5 corresponding to a region with amino acids GIRAYEQLGQRAFGPAGKVVVATVICLHNVGAMSSYLFIIKSELPLVIGT
- Top Product
- Discover our top product Slc38a5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC38A5 Blocking Peptide, catalog no. 33R-3343, is also available for use as a blocking control in assays to test for specificity of this SLC38A5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Slc38a5 (Solute Carrier Family 38, Member 5 (Slc38a5))
- Alternative Name
- SLC38A5 (Slc38a5 Products)
- Synonyms
- MGC80848 antibody, slc38a3 antibody, SN2 antibody, JM24 antibody, SNAT5 antibody, pp7194 antibody, C81234 antibody, E330031E14 antibody, solute carrier family 38 member 5 S homeolog antibody, solute carrier family 38 member 5 antibody, solute carrier family 38, member 5 antibody, slc38a5.S antibody, SLC38A5 antibody, slc38a5 antibody, Slc38a5 antibody
- Background
- The protein encoded by this gene is a system N sodium-coupled amino acid transporter involved in the transfer of glutamine, asparagine, histidine, serine, alanine, and glycine.
- Molecular Weight
- 51 kDa (MW of target protein)
-