TMEM200B antibody (N-Term)

Catalog No. ABIN635385

Product Details anti-TMEM200B Antibody

Target: TMEM200B (Transmembrane Protein 200B (TMEM200B))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM200B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TTMB antibody was raised against the N terminal Of Ttmb

Purification: Affinity purified

Immunogen: TTMB antibody was raised using the N terminal Of Ttmb corresponding to a region with amino acids AGYWPHRAGAPGSRAANASSPQMSELRREGRGGGRAHGPHERLRLLGPVI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TTMB Blocking Peptide, catalog no. 33R-1238, is also available for use as a blocking control in assays to test for specificity of this TTMB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TTMB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM200B

Target: TMEM200B (Transmembrane Protein 200B (TMEM200B))

Alternative Name: TTMB (TMEM200B Products)

Synonyms: TTMB antibody, EG623230 antibody, transmembrane protein 200B antibody, TMEM200B antibody, Tmem200b antibody

Background: TTMB is a multi-pass membrane protein. It belongs to the TMEM200 family. The function of the TTMB protein remains unknown.

Molecular Weight: 33 kDa (MW of target protein)