ITPRIPL1 antibody (Inositol 1,4,5-Triphosphate Receptor Interacting Protein-Like 1) (C-Term)

Details for Product anti-ITPRIPL1 Antibody No. ABIN635394
Antigen
Epitope
C-Term
10
9
7
4
1
Reactivity
Human
25
3
2
2
2
2
1
Host
Rabbit
25
Clonality
Polyclonal
Conjugate
This ITPRIPL1 antibody is un-conjugated
2
2
2
2
2
2
Application
Western Blotting (WB)
25
16
Options
Immunogen KIAA1754 L antibody was raised using the C terminal of KIAA1754 corresponding to a region with amino acids IPIPKTFRNAEPVNLFQHLVLNPKAHSQAVEEFQNLLTQVKTLPHAPLAA
Specificity KIAA1754 L antibody was raised against the C terminal of KIAA1754
Purification Affinity purified
Antigen
Alternative Name KIAA1754L
Background The function of KIAA1754L protein is not widely studied, and is yet to be elucidated fully.
Molecular Weight 63 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

KIAA1754L Blocking Peptide, catalog no. 33R-4091, is also available for use as a blocking control in assays to test for specificity of this KIAA1754L antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA1750 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Inositol 1,4,5-Triphosphate Receptor Interacting Protein-Like 1 (ITPRIPL1) (C-Term) antibody (ABIN635394) KIAA1754L antibody used at 1 ug/ml to detect target protein.