ITPRIPL1 antibody (C-Term)
-
- Target See all ITPRIPL1 products
- ITPRIPL1 (Inositol 1,4,5-Triphosphate Receptor Interacting Protein-Like 1 (ITPRIPL1))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ITPRIPL1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KIAA1754 L antibody was raised against the C terminal of KIAA1754
- Purification
- Affinity purified
- Immunogen
- KIAA1754 L antibody was raised using the C terminal of KIAA1754 corresponding to a region with amino acids IPIPKTFRNAEPVNLFQHLVLNPKAHSQAVEEFQNLLTQVKTLPHAPLAA
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KIAA1754L Blocking Peptide, catalog no. 33R-4091, is also available for use as a blocking control in assays to test for specificity of this KIAA1754L antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA1750 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ITPRIPL1 (Inositol 1,4,5-Triphosphate Receptor Interacting Protein-Like 1 (ITPRIPL1))
- Alternative Name
- KIAA1754L (ITPRIPL1 Products)
- Synonyms
- 1700041B20Rik antibody, KIAA1754L antibody, inositol 1,4,5-triphosphate receptor interacting protein-like 1 antibody, ITPRIP like 1 antibody, inositol 1,4,5-trisphosphate receptor interacting protein-like 1 antibody, Itpripl1 antibody, ITPRIPL1 antibody
- Background
- The function of KIAA1754L protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 63 kDa (MW of target protein)
-