FAM171A1 antibody (Middle Region)
-
- Target See all FAM171A1 (C10ORF38) products
- FAM171A1 (C10ORF38) (Chromosome 10 Open Reading Frame 38 (C10ORF38))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FAM171A1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C10 ORF38 antibody was raised against the middle region of C10 rf38
- Purification
- Affinity purified
- Immunogen
- C10 ORF38 antibody was raised using the middle region of C10 rf38 corresponding to a region with amino acids ARKSMEREGYESSGNDDYRGSYNTVLSQPLFEKQDREGPASTGSKLTIQE
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C10ORF38 Blocking Peptide, catalog no. 33R-1479, is also available for use as a blocking control in assays to test for specificity of this C10ORF38 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF38 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FAM171A1 (C10ORF38) (Chromosome 10 Open Reading Frame 38 (C10ORF38))
- Alternative Name
- C10ORF38 (C10ORF38 Products)
- Synonyms
- C10orf38 antibody, family with sequence similarity 171 member A1 antibody, family with sequence similarity 171, member A1 antibody, FAM171A1 antibody
- Background
- C10orf38 is probably involved in oxidoreductase activity.
- Molecular Weight
- 98 kDa (MW of target protein)
-