SPINT1 antibody (Middle Region)

Catalog No. ABIN635406

Product Details anti-SPINT1 Antibody

Target: SPINT1 (serine Peptidase Inhibitor, Kunitz Type 1 (SPINT1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SPINT1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SPINT1 antibody was raised against the middle region of SPINT1

Purification: Affinity purified

Immunogen: SPINT1 antibody was raised using the middle region of SPINT1 corresponding to a region with amino acids PFSEHCARFTYGGCYGNKNNFEEEQQCLESCRGISKKDVFGLRREIPIPS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SPINT1 Blocking Peptide, catalog no. 33R-7084, is also available for use as a blocking control in assays to test for specificity of this SPINT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPINT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SPINT1

Target: SPINT1 (serine Peptidase Inhibitor, Kunitz Type 1 (SPINT1))

Alternative Name: SPINT1 (SPINT1 Products)

Synonyms: HAI-1 antibody, HAI antibody, HAI1 antibody, MANSC2 antibody, cb376 antibody, sb:cb376 antibody, spint1l antibody, zgc:64075 antibody, serine peptidase inhibitor, Kunitz type 1 antibody, serine protease inhibitor, Kunitz type 1 antibody, serine peptidase inhibitor, Kunitz type 1 b antibody, serine peptidase inhibitor, Kunitz type 1 a antibody, SPINT1 antibody, Spint1 antibody, spint1b antibody, spint1a antibody

Background: The protein encoded by this gene is a member of the Kunitz family of serine protease inhibitors. The protein is a potent inhibitor specific for HGF activator and is thought to be involved in the regulation of the proteolytic activation of HGF.

Molecular Weight: 53 kDa (MW of target protein)