ART3 antibody (Middle Region)
-
- Target See all ART3 Antibodies
- ART3 (ADP-Ribosyltransferase 3 (ART3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ART3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ART3 antibody was raised against the middle region of ART3
- Purification
- Affinity purified
- Immunogen
- ART3 antibody was raised using the middle region of ART3 corresponding to a region with amino acids LEPTQIPAPGPVPVPGPKSHPSASSGKLLLPQFGMVIILISVSAINLFVA
- Top Product
- Discover our top product ART3 Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ART3 Blocking Peptide, catalog no. 33R-4921, is also available for use as a blocking control in assays to test for specificity of this ART3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ART3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ART3 (ADP-Ribosyltransferase 3 (ART3))
- Alternative Name
- ART3 (ART3 Products)
- Synonyms
- ARTC3 antibody, 4930569O04Rik antibody, ART3 antibody, DKFZp468P1925 antibody, ADP-ribosyltransferase 3 antibody, ART3 antibody, Art3 antibody
- Background
- ADP-ribosylation is a reversible posttranslational modification used to regulate protein function.
- Molecular Weight
- 40 kDa (MW of target protein)
-