PPP1R3A antibody
-
- Target See all PPP1R3A Antibodies
- PPP1R3A (Protein Phosphatase 1, Regulatory Subunit 3A (PPP1R3A))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PPP1R3A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PPP1 R1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEPSEVPSQISKDNFLEVPNLSDSLCEDEEVTFQPGFSPQPSRRGSDSSE
- Top Product
- Discover our top product PPP1R3A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PPP1R3A Blocking Peptide, catalog no. 33R-5946, is also available for use as a blocking control in assays to test for specificity of this PPP1R3A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPP1R3A (Protein Phosphatase 1, Regulatory Subunit 3A (PPP1R3A))
- Alternative Name
- PPP1R3A (PPP1R3A Products)
- Synonyms
- GM antibody, RG1 antibody, RGL antibody, PP1G antibody, PPP1R3 antibody, PPP1R3A antibody, protein phosphatase 1, regulatory (inhibitor) subunit 3A antibody, protein phosphatase 1 regulatory subunit 3A antibody, Ppp1r3a antibody, PPP1R3A antibody
- Background
- The glycogen-associated form of protein phosphatase-1 (PP1) derived from skeletal muscle is a heterodimer composed of a 37 kDa catalytic subunit and a 124 kDa targeting and regulatory subunit.
- Molecular Weight
- 126 kDa (MW of target protein)
- Pathways
- Cellular Glucan Metabolic Process
-