TMEM38B antibody (C-Term)
-
- Target See all TMEM38B Antibodies
- TMEM38B (Transmembrane Protein 38B (TMEM38B))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TMEM38B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TMEM38 B antibody was raised against the C terminal of TMEM38
- Purification
- Affinity purified
- Immunogen
- TMEM38 B antibody was raised using the C terminal of TMEM38 corresponding to a region with amino acids WMLFGWQQPFSSCEKKSEAKSPSNGVGSLASKPVDVASDNVKKKHTKKNE
- Top Product
- Discover our top product TMEM38B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TMEM38B Blocking Peptide, catalog no. 33R-9980, is also available for use as a blocking control in assays to test for specificity of this TMEM38B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM30 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMEM38B (Transmembrane Protein 38B (TMEM38B))
- Alternative Name
- TMEM38B (TMEM38B Products)
- Synonyms
- zgc:55815 antibody, tricb antibody, tric-b antibody, MGC83592 antibody, DKFZp469C0220 antibody, C9orf87 antibody, D4Ertd89e antibody, OI14 antibody, TRIC-B antibody, TRICB antibody, bA219P18.1 antibody, 1600017F22Rik antibody, AA437809 antibody, AV051057 antibody, mg33b antibody, RGD1305703 antibody, transmembrane protein 38B antibody, transmembrane protein 38B L homeolog antibody, tmem38b antibody, TMEM38B antibody, tmem38b.L antibody, Tmem38b antibody
- Background
- TMEM38B is a monovalent cation channel required for maintenance of rapid intracellular calcium release. It may act as a potassium counter-ion channel that functions in synchronization with calcium release from intracellular stores.
- Molecular Weight
- 32 kDa (MW of target protein)
-