Junctophilin 1 antibody (C-Term)
-
- Target See all Junctophilin 1 (JPH1) Antibodies
- Junctophilin 1 (JPH1)
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Junctophilin 1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Junctophilin 1 antibody was raised against the C terminal of JPH1
- Purification
- Affinity purified
- Immunogen
- Junctophilin 1 antibody was raised using the C terminal of JPH1 corresponding to a region with amino acids SNGELHSQYHGYYVKLNAPQHPPVDVEDGDGSSQSSSALVHKPSANKWSP
- Top Product
- Discover our top product JPH1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Junctophilin 1 Blocking Peptide, catalog no. 33R-8651, is also available for use as a blocking control in assays to test for specificity of this Junctophilin 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JPH1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Junctophilin 1 (JPH1)
- Alternative Name
- Junctophilin 1 (JPH1 Products)
- Synonyms
- JP-1 antibody, JP1 antibody, ENSMUSG00000054314 antibody, Jp1 antibody, bZ1M12.3 antibody, jph1 antibody, si:rp71-1m12.3 antibody, Jph1 antibody, junctophilin 1 antibody, junctophilin 1a antibody, junctophilin-1 antibody, JPH1 antibody, Jph1 antibody, jph1 antibody, jph1a antibody, LOC100547979 antibody
- Background
- Junctional complexes between the plasma membrane and endoplasmic/sarcoplasmic reticulum are a common feature of all excitable cell types and mediate cross talk between cell surface and intracellular ion channels. JPH1 is a component of junctional complexes and is composed of a C-terminal hydrophobic segment spanning the endoplasmic/sarcoplasmic reticulum membrane and a remaining cytoplasmic domain that shows specific affinity for the plasma membrane.
- Molecular Weight
- 72 kDa (MW of target protein)
-