TMCC3 antibody (N-Term)

Catalog No. ABIN635473

Product Details anti-TMCC3 Antibody

Target: TMCC3 (Transmembrane and Coiled-Coil Domain Family 3 (TMCC3))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMCC3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMCC3 antibody was raised against the N terminal of TMCC3

Purification: Affinity purified

Immunogen: TMCC3 antibody was raised using the N terminal of TMCC3 corresponding to a region with amino acids MPGSDTALTVDRTYSDPGRHHRCKSRVERHDMNTLSLPLNIRRGGSDTNL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMCC3 Blocking Peptide, catalog no. 33R-6283, is also available for use as a blocking control in assays to test for specificity of this TMCC3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMCC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMCC3

Target: TMCC3 (Transmembrane and Coiled-Coil Domain Family 3 (TMCC3))

Alternative Name: TMCC3 (TMCC3 Products)

Synonyms: wu:fb81d10 antibody, wu:fb83h01 antibody, wu:fk68a09 antibody, wu:fl22e07 antibody, si:dkey-183c16.4 antibody, DKFZp469H0211 antibody, AW488095 antibody, C630016B22Rik antibody, C88213 antibody, Tmcc1 antibody, RGD1307241 antibody, transmembrane and coiled-coil domain family 3 antibody, transmembrane and coiled coil domains 3 antibody, tmcc3 antibody, TMCC3 antibody, Tmcc3 antibody

Background: The function of TMCC3 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 54 kDa (MW of target protein)