RNFT2 antibody (N-Term)

Catalog No. ABIN635491

Product Details anti-RNFT2 Antibody

Target: RNFT2 (Ring Finger Protein, Transmembrane 2 (RNFT2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RNFT2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMEM118 antibody was raised against the N terminal Of Tmem118

Purification: Affinity purified

Immunogen: TMEM118 antibody was raised using the N terminal Of Tmem118 corresponding to a region with amino acids HGGHRGGSLLQHVGGDHRGHSEEGGDEQPGTPAPALSELKAVICWLQKGL

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM118 Blocking Peptide, catalog no. 33R-3736, is also available for use as a blocking control in assays to test for specificity of this TMEM118 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM118 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RNFT2

Target: RNFT2 (Ring Finger Protein, Transmembrane 2 (RNFT2))

Alternative Name: TMEM118 (RNFT2 Products)

Synonyms: TMEM118 antibody, AW049082 antibody, B830028P19Rik antibody, Tmem118 antibody, RGD1560195 antibody, RNFT2 antibody, si:dkey-175n1.1 antibody, zgc:109947 antibody, ring finger protein, transmembrane 2 antibody, RNFT2 antibody, Rnft2 antibody, rnft2 antibody

Background: TMEM118 is a multi-pass membrane protein, and contains 1 RING-type zinc finger. The function of TMEM118 remains unknown.

Molecular Weight: 46 kDa (MW of target protein)