PRSS16 antibody
-
- Target See all PRSS16 Antibodies
- PRSS16 (Protease, serine, 16 (Thymus) (PRSS16))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PRSS16 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PRSS16 antibody was raised using a synthetic peptide corresponding to a region with amino acids SHSTPYCGLRRAVQIVLHSLGQKCLSFSRAETVAQLRSTEPQLSGVGDRQ
- Top Product
- Discover our top product PRSS16 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PRSS16 Blocking Peptide, catalog no. 33R-8518, is also available for use as a blocking control in assays to test for specificity of this PRSS16 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRSS16 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRSS16 (Protease, serine, 16 (Thymus) (PRSS16))
- Alternative Name
- PRSS16 (PRSS16 Products)
- Synonyms
- TSSP antibody, AI448615 antibody, protease, serine 16 antibody, protease, serine 16 S homeolog antibody, protease, serine 16 (thymus) antibody, PRSS16 antibody, prss16.S antibody, prss16 antibody, Prss16 antibody
- Background
- This gene encodes a serine protease expressed exclusively in the thymus. It is thought to play a role in the alternative antigen presenting pathway used by cortical thymic epithelial cells during the positive selection of T cells.
- Molecular Weight
- 55 kDa (MW of target protein)
-