PIPOX antibody (C-Term)

Catalog No. ABIN635559

Product Details anti-PIPOX Antibody

Target: PIPOX (Pipecolic Acid Oxidase (PIPOX))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PIPOX antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PIPOX antibody was raised against the C terminal of PIPOX

Purification: Affinity purified

Immunogen: PIPOX antibody was raised using the C terminal of PIPOX corresponding to a region with amino acids FVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNIVIGAGFSGHG

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PIPOX Blocking Peptide, catalog no. 33R-3119, is also available for use as a blocking control in assays to test for specificity of this PIPOX antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIPOX antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PIPOX

Target: PIPOX (Pipecolic Acid Oxidase (PIPOX))

Alternative Name: PIPOX (PIPOX Products)

Synonyms: LPIPOX antibody, Pso antibody, SOX antibody, pipecolic acid and sarcosine oxidase antibody, pipecolic acid oxidase antibody, pipecolic acid oxidase L homeolog antibody, PIPOX antibody, Pipox antibody, pipox antibody, pipox.L antibody

Background: PIPOX metabolizes sarcosine, L-pipecolic acid and L-proline.

Molecular Weight: 43 kDa (MW of target protein)