ZDHHC24 antibody (N-Term)

Catalog No. ABIN635580

Product Details anti-ZDHHC24 Antibody

Target: ZDHHC24 (Zinc Finger, DHHC-Type Containing 24 (ZDHHC24))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZDHHC24 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ZDHHC24 antibody was raised against the N terminal of ZDHHC24

Purification: Affinity purified

Immunogen: ZDHHC24 antibody was raised using the N terminal of ZDHHC24 corresponding to a region with amino acids YVLVLGPGPPPLGPLARALQLALAAFQLLNLLGNVGLFLRSDPSIRGVML

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ZDHHC24 Blocking Peptide, catalog no. 33R-10279, is also available for use as a blocking control in assays to test for specificity of this ZDHHC24 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZDHHC24 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ZDHHC24

Target: ZDHHC24 (Zinc Finger, DHHC-Type Containing 24 (ZDHHC24))

Alternative Name: ZDHHC24 (ZDHHC24 Products)

Synonyms: zgc:91907 antibody, wu:fe02b01 antibody, 5730496N17Rik antibody, Leng4 antibody, zinc finger, DHHC-type containing 24 antibody, zinc finger DHHC-type containing 24 antibody, zinc finger, DHHC domain containing 24 antibody, zdhhc24 antibody, ZDHHC24 antibody, Zdhhc24 antibody

Background: The function of ZDHHC24 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 30 kDa (MW of target protein)