ZDHHC24 antibody (N-Term)
-
- Target See all ZDHHC24 products
- ZDHHC24 (Zinc Finger, DHHC-Type Containing 24 (ZDHHC24))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ZDHHC24 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ZDHHC24 antibody was raised against the N terminal of ZDHHC24
- Purification
- Affinity purified
- Immunogen
- ZDHHC24 antibody was raised using the N terminal of ZDHHC24 corresponding to a region with amino acids YVLVLGPGPPPLGPLARALQLALAAFQLLNLLGNVGLFLRSDPSIRGVML
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ZDHHC24 Blocking Peptide, catalog no. 33R-10279, is also available for use as a blocking control in assays to test for specificity of this ZDHHC24 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZDHHC24 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ZDHHC24 (Zinc Finger, DHHC-Type Containing 24 (ZDHHC24))
- Alternative Name
- ZDHHC24 (ZDHHC24 Products)
- Synonyms
- zgc:91907 antibody, wu:fe02b01 antibody, 5730496N17Rik antibody, Leng4 antibody, zinc finger, DHHC-type containing 24 antibody, zinc finger DHHC-type containing 24 antibody, zinc finger, DHHC domain containing 24 antibody, zdhhc24 antibody, ZDHHC24 antibody, Zdhhc24 antibody
- Background
- The function of ZDHHC24 protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 30 kDa (MW of target protein)
-