LRRC37A3 antibody (Middle Region)

Catalog No. ABIN635583

Product Details anti-LRRC37A3 Antibody

Target: LRRC37A3 (Leucine Rich Repeat Containing 37, Member A3 (LRRC37A3))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LRRC37A3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LRRC37 A3 antibody was raised against the middle region of LRRC37 3

Purification: Affinity purified

Immunogen: LRRC37 A3 antibody was raised using the middle region of LRRC37 3 corresponding to a region with amino acids NYTSTELIIEPEEPSDSSGINLSGFGSEQLDTNDESDVTSTLSYILPYFS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LRRC37A3 Blocking Peptide, catalog no. 33R-6945, is also available for use as a blocking control in assays to test for specificity of this LRRC37A3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC30 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LRRC37A3

Target: LRRC37A3 (Leucine Rich Repeat Containing 37, Member A3 (LRRC37A3))

Alternative Name: LRRC37A3 (LRRC37A3 Products)

Synonyms: LRRC37A antibody, Lrrc37a3 antibody, RGD1559753 antibody, leucine rich repeat containing 37 member A3 antibody, leucine rich repeat containing 37A antibody, leucine-rich repeat-containing protein 37A2 antibody, leucine-rich repeat-containing protein 37A3 antibody, LRRC37A3 antibody, Lrrc37a antibody, LOC454756 antibody, LOC714675 antibody

Background: The function of LRRC37A3 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 180 kDa (MW of target protein)