ZP1 antibody

Catalog No. ABIN635633

Product Details anti-ZP1 Antibody

Target: ZP1 (Zona Pellucida Glycoprotein 1 (ZP1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZP1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ZP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TLEHWDVNKRDYIGTHLSQEQCQVASGHLPCIVRRTSKEACQQAGCCYDN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ZP1 Blocking Peptide, catalog no. 33R-9168, is also available for use as a blocking control in assays to test for specificity of this ZP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ZP1

Target: ZP1 (Zona Pellucida Glycoprotein 1 (ZP1))

Alternative Name: ZP1 (ZP1 Products)

Synonyms: zona pellucida glycoprotein 1 (sperm receptor) antibody, zona pellucida glycoprotein 1 antibody, ZP1 antibody, Zp1 antibody

Background: The mammalian zona pellucida, which mediates species-specific sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy, is composed of three to four glycoproteins, ZP1, ZP2, ZP3, and ZP4. ZP1 ensures the structural integrity of the zona pellucida.

Molecular Weight: 70 kDa (MW of target protein)