Surfactant Protein C antibody (N-Term)
-
- Target See all Surfactant Protein C (SFTPC) Antibodies
- Surfactant Protein C (SFTPC)
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Surfactant Protein C antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SFTPC antibody was raised against the N terminal of SFTPC
- Purification
- Affinity purified
- Immunogen
- SFTPC antibody was raised using the N terminal of SFTPC corresponding to a region with amino acids MDVGSKEVLMESPPDYSAAPRGRFGIPCCPVHLKRLLIVVVVVVLIVVVI
- Top Product
- Discover our top product SFTPC Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SFTPC Blocking Peptide, catalog no. 33R-5881, is also available for use as a blocking control in assays to test for specificity of this SFTPC antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFTPC antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Surfactant Protein C (SFTPC)
- Alternative Name
- SFTPC (SFTPC Products)
- Synonyms
- SFTPC antibody, SPC antibody, SP-C antibody, psp-c antibody, sftp2 antibody, xSP-C antibody, Bricd6 antibody, SP5 antibody, Sftp-2 antibody, Sftp2 antibody, pro-SpC antibody, BRICD6 antibody, PSP-C antibody, SFTP2 antibody, SMDP2 antibody, surfactant protein C antibody, surfactant, pulmonary-associated protein C S homeolog antibody, surfactant, pulmonary-associated protein C antibody, surfactant associated protein C antibody, SFTPC antibody, sftpc.S antibody, sftpc antibody, Sftpc antibody
- Background
- This gene encodes the pulmonary-associated surfactant protein C (SPC), an extremely hydrophobic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a surface-active lipoprotein complex composed of 90% lipids.
- Molecular Weight
- 21 kDa (MW of target protein)
-