P4HTM antibody (Middle Region)
-
- Target See all P4HTM Antibodies
- P4HTM (Prolyl 4-Hydroxylase, Transmembrane (Endoplasmic Reticulum) (P4HTM))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This P4HTM antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PH4 antibody was raised against the middle region of PH-4
- Purification
- Affinity purified
- Immunogen
- PH4 antibody was raised using the middle region of PH-4 corresponding to a region with amino acids RLGNGWWMTPESIQEMYAAIKADPDGDGVLSLQEFSNMDLRDFHKYMRSH
- Top Product
- Discover our top product P4HTM Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PH4 Blocking Peptide, catalog no. 33R-8025, is also available for use as a blocking control in assays to test for specificity of this PH4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PH-4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- P4HTM (Prolyl 4-Hydroxylase, Transmembrane (Endoplasmic Reticulum) (P4HTM))
- Alternative Name
- PH4 (P4HTM Products)
- Synonyms
- Ph-4 antibody, RGD1311848 antibody, EGLN4 antibody, HIFPH4 antibody, P4H-TM antibody, PH-4 antibody, PH4 antibody, PHD4 antibody, 4933406E20Rik antibody, AI853847 antibody, BB128974 antibody, prolyl 4-hydroxylase, transmembrane antibody, prolyl 4-hydroxylase, transmembrane (endoplasmic reticulum) antibody, shisa family member 5 antibody, P4htm antibody, P4HTM antibody, SHISA5 antibody
- Background
- The product of this gene belongs to the family of prolyl 4-hydroxylases. This protein is a prolyl hydroxylase that may be involved in the degradation of hypoxia-inducible transcription factors under normoxia.
- Molecular Weight
- 57 kDa (MW of target protein)
-