CHST8 antibody
-
- Target See all CHST8 Antibodies
- CHST8 (Carbohydrate (N-Acetylgalactosamine 4-0) Sulfotransferase 8 (CHST8))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CHST8 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- CHST8 antibody was raised using a synthetic peptide corresponding to a region with amino acids GCSNWKRVLMVLAGLASSTADIQHNTVHYGSALKRLDTFDRQGILHRLST
- Top Product
- Discover our top product CHST8 Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CHST8 Blocking Peptide, catalog no. 33R-3192, is also available for use as a blocking control in assays to test for specificity of this CHST8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHST8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CHST8 (Carbohydrate (N-Acetylgalactosamine 4-0) Sulfotransferase 8 (CHST8))
- Alternative Name
- CHST8 (CHST8 Products)
- Synonyms
- MGC146666 antibody, GALNAC4ST1 antibody, GalNAc4ST antibody, 1500011J21Rik antibody, AI426009 antibody, carbohydrate sulfotransferase 8 antibody, carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 8 antibody, CHST8 antibody, chst8 antibody, Chst8 antibody
- Background
- Sulfate groups in carbohydrates confer highly specific functions on glycoproteins, glycolipids, and proteoglycans and are critical for cell-cell interaction, signal transduction, and embryonic development. Sulfotransferases, such as CHST8, carry out sulfation of carbohydrates.
- Molecular Weight
- 49 kDa (MW of target protein)
-