Unc5c antibody
-
- Target See all Unc5c Antibodies
- Unc5c (Unc-5 Homolog C (C. Elegans) (Unc5c))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Unc5c antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- UNC5 C antibody was raised using a synthetic peptide corresponding to a region with amino acids WRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQNFPDGNLSMLAAVLEE
- Top Product
- Discover our top product Unc5c Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
UNC5C Blocking Peptide, catalog no. 33R-10004, is also available for use as a blocking control in assays to test for specificity of this UNC5C antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UNC0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Unc5c (Unc-5 Homolog C (C. Elegans) (Unc5c))
- Alternative Name
- UNC5C (Unc5c Products)
- Synonyms
- UNC5C antibody, UNC5H3 antibody, 6030473H24 antibody, AI047720 antibody, B130051O18Rik antibody, Unc5h3 antibody, rcm antibody, wu:fb03d07 antibody, unc-5 netrin receptor C antibody, UNC5C antibody, Unc5c antibody, unc5c antibody
- Background
- UNC5C belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediate the repellent response to netrin, they are transmembrane proteins containing 2 immunoglobulin (Ig)-like domains and 2 type I thrombospondin motifs in the extracellular region.
- Molecular Weight
- 103 kDa (MW of target protein)
-