CHST13 antibody
-
- Target See all CHST13 Antibodies
- CHST13 (Carbohydrate (Chondroitin 4) Sulfotransferase 13 (CHST13))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CHST13 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- CHST13 antibody was raised using a synthetic peptide corresponding to a region with amino acids CHPCRLRYDVVGKFETLAEDAAFVLGLAGASDLSFPGPPRPRGAAASRDL
- Top Product
- Discover our top product CHST13 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CHST13 Blocking Peptide, catalog no. 33R-1710, is also available for use as a blocking control in assays to test for specificity of this CHST13 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHST13 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CHST13 (Carbohydrate (Chondroitin 4) Sulfotransferase 13 (CHST13))
- Alternative Name
- CHST13 (CHST13 Products)
- Synonyms
- C4ST3 antibody, carbohydrate sulfotransferase 13 antibody, CHST13 antibody
- Background
- CHST13 catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of chondroitin.
- Molecular Weight
- 39 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-