ZP4 antibody (N-Term)
-
- Target See all ZP4 Antibodies
- ZP4 (Zona Pellucida Glycoprotein 4 (ZP4))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ZP4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ZP4 antibody was raised against the N terminal of ZP4
- Purification
- Affinity purified
- Immunogen
- ZP4 antibody was raised using the N terminal of ZP4 corresponding to a region with amino acids MWLLRCVLLCVSLSLAVSGQHKPEAPDYSSVLHCGPWSFQFAVNLNQEAT
- Top Product
- Discover our top product ZP4 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ZP4 Blocking Peptide, catalog no. 33R-6616, is also available for use as a blocking control in assays to test for specificity of this ZP4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZP4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ZP4 (Zona Pellucida Glycoprotein 4 (ZP4))
- Alternative Name
- ZP4 (ZP4 Products)
- Synonyms
- ZPB antibody, xlZPB antibody, lzpb-a antibody, MGC154827 antibody, zbp antibody, zp1 antibody, ZBP antibody, TAC4 antibody, MGC154888 antibody, ZP1 antibody, Zp-4 antibody, ZP3-ALPHA antibody, ZP antibody, Zp-X antibody, zona pellucida glycoprotein 4 S homeolog antibody, zona pellucida glycoprotein 4 antibody, zona pellucida glycoprotein 4 L homeolog antibody, zp4.S antibody, zp4 antibody, ZP4 antibody, zp4.L antibody, Zp4 antibody
- Background
- The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. It is hypothesized that furin cleavage results in release of the mature protein from the plasma membrane for subsequent incorporation into the zona pellucida matrix.
- Molecular Weight
- 49 kDa (MW of target protein)
-