CJ057 antibody (Middle Region)

Catalog No. ABIN635765

Product Details anti-CJ057 Antibody

Target: CJ057 (C10ORF57) (Chromosome 10 Open Reading Frame 57 (C10ORF57))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CJ057 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C10 ORF57 antibody was raised against the middle region of C10 rf57

Purification: Affinity purified

Immunogen: C10 ORF57 antibody was raised using the middle region of C10 rf57 corresponding to a region with amino acids QSIPYQNLGPLGPFTQYLVDHHHTLLCNGYWLAWLIHVGESLYAIVLCKH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C10ORF57 Blocking Peptide, catalog no. 33R-7727, is also available for use as a blocking control in assays to test for specificity of this C10ORF57 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF57 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CJ057

Target: CJ057 (C10ORF57) (Chromosome 10 Open Reading Frame 57 (C10ORF57))

Alternative Name: C10ORF57 (C10ORF57 Products)

Synonyms: MGC131362 antibody, C10orf57 antibody, bA369J21.6 antibody, transmembrane protein 254 antibody, transmembrane protein 254 L homeolog antibody, TMEM254 antibody, tmem254 antibody, tmem254.L antibody

Background: C10orf57 encodes a transmembrane protein.

Molecular Weight: 14 kDa (MW of target protein)