CJ057 antibody (Middle Region)
-
- Target See all CJ057 (C10ORF57) products
- CJ057 (C10ORF57) (Chromosome 10 Open Reading Frame 57 (C10ORF57))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CJ057 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C10 ORF57 antibody was raised against the middle region of C10 rf57
- Purification
- Affinity purified
- Immunogen
- C10 ORF57 antibody was raised using the middle region of C10 rf57 corresponding to a region with amino acids QSIPYQNLGPLGPFTQYLVDHHHTLLCNGYWLAWLIHVGESLYAIVLCKH
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C10ORF57 Blocking Peptide, catalog no. 33R-7727, is also available for use as a blocking control in assays to test for specificity of this C10ORF57 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF57 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CJ057 (C10ORF57) (Chromosome 10 Open Reading Frame 57 (C10ORF57))
- Alternative Name
- C10ORF57 (C10ORF57 Products)
- Synonyms
- MGC131362 antibody, C10orf57 antibody, bA369J21.6 antibody, transmembrane protein 254 antibody, transmembrane protein 254 L homeolog antibody, TMEM254 antibody, tmem254 antibody, tmem254.L antibody
- Background
- C10orf57 encodes a transmembrane protein.
- Molecular Weight
- 14 kDa (MW of target protein)
-