Receptor Accessory Protein 1 antibody (Middle Region)
-
- Target See all Receptor Accessory Protein 1 (REEP1) Antibodies
- Receptor Accessory Protein 1 (REEP1)
-
Binding Specificity
- Middle Region
-
Reactivity
- Mouse, Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Receptor Accessory Protein 1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- REEP1 antibody was raised against the middle region of REEP1
- Purification
- Affinity purified
- Immunogen
- REEP1 antibody was raised using the middle region of REEP1 corresponding to a region with amino acids AKDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTI
- Top Product
- Discover our top product REEP1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
REEP1 Blocking Peptide, catalog no. 33R-1288, is also available for use as a blocking control in assays to test for specificity of this REEP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of REEP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Receptor Accessory Protein 1 (REEP1)
- Alternative Name
- REEP1 (REEP1 Products)
- Synonyms
- C2orf23 antibody, HMN5B antibody, SPG31 antibody, D6Ertd253e antibody, RGD1305230 antibody, receptor accessory protein 1 antibody, REEP1 antibody, Reep1 antibody
- Background
- REEP1 belongs to the DP1 family and may enhance the cell surface expression of odorant receptors.
- Molecular Weight
- 22 kDa (MW of target protein)
-