CYP4X1 antibody (Middle Region)
-
- Target See all CYP4X1 Antibodies
- CYP4X1 (Cytochrome P450, Family 4, Subfamily X, Polypeptide 1 (CYP4X1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CYP4X1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CYP4 X1 antibody was raised against the middle region of CYP4 1
- Purification
- Affinity purified
- Immunogen
- CYP4 X1 antibody was raised using the middle region of CYP4 1 corresponding to a region with amino acids LDIVLSAKDESGSSFSDIDVHSEVSTFLLAGHDTLAASISWILYCLALNP
- Top Product
- Discover our top product CYP4X1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CYP4X1 Blocking Peptide, catalog no. 33R-4850, is also available for use as a blocking control in assays to test for specificity of this CYP4X1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CYP4X1 (Cytochrome P450, Family 4, Subfamily X, Polypeptide 1 (CYP4X1))
- Alternative Name
- CYP4X1 (CYP4X1 Products)
- Synonyms
- CYPIVX1 antibody, A230025G20 antibody, CYP_a antibody, Cyp4a28-ps antibody, cytochrome P450 family 4 subfamily X member 1 antibody, cytochrome P450, family 4, subfamily x, polypeptide 1 antibody, CYP4X1 antibody, Cyp4x1 antibody
- Background
- This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The expression pattern of a similar rat protein suggests that this protein may be involved in neurovascular function in the brain.
- Molecular Weight
- 59 kDa (MW of target protein)
- Pathways
- Regulation of Lipid Metabolism by PPARalpha
-