CYP4X1 antibody (Middle Region)

Catalog No. ABIN635822

Product Details anti-CYP4X1 Antibody

Target: CYP4X1 (Cytochrome P450, Family 4, Subfamily X, Polypeptide 1 (CYP4X1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CYP4X1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CYP4 X1 antibody was raised against the middle region of CYP4 1

Purification: Affinity purified

Immunogen: CYP4 X1 antibody was raised using the middle region of CYP4 1 corresponding to a region with amino acids LDIVLSAKDESGSSFSDIDVHSEVSTFLLAGHDTLAASISWILYCLALNP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CYP4X1 Blocking Peptide, catalog no. 33R-4850, is also available for use as a blocking control in assays to test for specificity of this CYP4X1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CYP4X1

Target: CYP4X1 (Cytochrome P450, Family 4, Subfamily X, Polypeptide 1 (CYP4X1))

Alternative Name: CYP4X1 (CYP4X1 Products)

Synonyms: CYPIVX1 antibody, A230025G20 antibody, CYP_a antibody, Cyp4a28-ps antibody, cytochrome P450 family 4 subfamily X member 1 antibody, cytochrome P450, family 4, subfamily x, polypeptide 1 antibody, CYP4X1 antibody, Cyp4x1 antibody

Background: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The expression pattern of a similar rat protein suggests that this protein may be involved in neurovascular function in the brain.

Molecular Weight: 59 kDa (MW of target protein)

Pathways: Regulation of Lipid Metabolism by PPARalpha