TMED10 antibody
-
- Target See all TMED10 Antibodies
- TMED10 (Transmembrane Emp24-Like Trafficking Protein 10 (TMED10))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TMED10 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- TMED10 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIF
- Top Product
- Discover our top product TMED10 Primary Antibody
-
anti-Transmembrane Emp24-Like Trafficking Protein 10 (TMED10) (AA 101-200) antibody
TMED10 Reactivity: Human, Mouse WB, ELISA, IHC (p), IF (cc), IF (p), IHC (fro), ICC Host: Rabbit Polyclonal unconjugated
anti-Transmembrane Emp24-Like Trafficking Protein 10 (TMED10) (C-Term) antibodyVerified TMED10 Reactivity: Human ELISA, IF, FACS Host: Goat Polyclonal unconjugated
anti-Transmembrane Emp24-Like Trafficking Protein 10 (TMED10) (AA 156-185), (C-Term) antibodyTMED10 Reactivity: Human WB Host: Rabbit Polyclonal RB40979 unconjugated
anti-Transmembrane Emp24-Like Trafficking Protein 10 (TMED10) (AA 143-192) antibodyTMED10 Reactivity: Human, Mouse, Rat, Rabbit, Cow, Hamster, Xenopus laevis, Dog, Monkey, Horse, Zebrafish (Danio rerio), Chicken, Guinea Pig, Pig WB Host: Rabbit Polyclonal unconjugated
anti-Transmembrane Emp24-Like Trafficking Protein 10 (TMED10) (AA 100-200) antibodyTMED10 Reactivity: Human, Mouse, Rat, Rabbit, Cow, Hamster, Primate, Monkey, Chicken WB Host: Rabbit Polyclonal unconjugated
anti-Transmembrane Emp24-Like Trafficking Protein 10 (TMED10) (AA 50-150) antibodyTMED10 Reactivity: Human, Mouse, Rat, Rabbit, Cow, Hamster, Primate, Xenopus laevis, Frog, Monkey WB, IHC Host: Rabbit Polyclonal unconjugated
anti-Transmembrane Emp24-Like Trafficking Protein 10 (TMED10) (AA 100-200) antibodyTMED10 Reactivity: Human, Mouse, Rat, Rabbit WB, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Transmembrane Emp24-Like Trafficking Protein 10 (TMED10) (C-Term) antibodyTMED10 Reactivity: Human, Mouse, Rat WB, IHC (p), EIA Host: Rabbit Polyclonal unconjugated
anti-Transmembrane Emp24-Like Trafficking Protein 10 (TMED10) (Center) antibodyTMED10 Reactivity: Human, Mouse, Rat WB, IHC (p), EIA Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TMED10 Blocking Peptide, catalog no. 33R-4515, is also available for use as a blocking control in assays to test for specificity of this TMED10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMED10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMED10 (Transmembrane Emp24-Like Trafficking Protein 10 (TMED10))
- Alternative Name
- TMED10 (TMED10 Products)
- Synonyms
- tmp21 antibody, P24(DELTA) antibody, S31I125 antibody, S31III125 antibody, TMP21 antibody, Tmp-21-I antibody, p23 antibody, 1110014C03Rik antibody, Tmp21 antibody, p24delta1 antibody, fe06g04 antibody, wu:fb98e10 antibody, wu:fe06g04 antibody, zgc:85681 antibody, transmembrane p24 trafficking protein 10 L homeolog antibody, transmembrane p24 trafficking protein 10 antibody, tmed10.L antibody, TMED10 antibody, Tmed10 antibody, tmed10 antibody
- Background
- This gene is a member of the EMP24/GP25L/p24 family and encodes a protein with a GOLD domain. This type I membrane protein is localized to the plasma membrane and golgi cisternae and is involved in vesicular protein trafficking.
- Molecular Weight
- 24 kDa (MW of target protein)
-
