BACE1 antibody (N-Term)

Catalog No. ABIN635849

Product Details anti-BACE1 Antibody

Target: BACE1 (Beta-secretase 1 (BACE1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BACE1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: BACE1 antibody was raised against the N terminal of BACE1

Purification: Affinity purified

Immunogen: BACE1 antibody was raised using the N terminal of BACE1 corresponding to a region with amino acids GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BACE1 Blocking Peptide, catalog no. 33R-3496, is also available for use as a blocking control in assays to test for specificity of this BACE1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BACE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BACE1

Target: BACE1 (Beta-secretase 1 (BACE1))

Alternative Name: BACE1 (BACE1 Products)

Synonyms: ASP2 antibody, BACE antibody, HSPC104 antibody, C76936 antibody, Bace antibody, MGC145931 antibody, BACE1 antibody, zgc:77409 antibody, beta-secretase 1 antibody, beta-site APP cleaving enzyme 1 antibody, beta-site APP-cleaving enzyme 1 antibody, BACE1 antibody, Bace1 antibody, bace1 antibody

Background: Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein (APP) by two proteases, one of which is the protein. BACE1, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease that is found mainly in the Golgi.

Molecular Weight: 51 kDa (MW of target protein)